PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g024229m
Common NameCISIN_1g024229mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 271aa    MW: 30146.4 Da    PI: 8.8069
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g024229mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.6e-3955115363
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                        e+ l+cprC+st+tkfCyynnys sqPr+fCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  orange1.1g024229m  55 ERVLNCPRCNSTDTKFCYYNNYSFSQPRHFCKTCRRYWTAGGSLRNVPVGGGSRKNKRSSS 115
                        67899****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2146103IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3356112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.27358112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDTAYHWPQK SQKSYYNLLY CFCNPSPICK GIGFVTPMEA GSNPTLERRP KPQRERVLNC  60
PRCNSTDTKF CYYNNYSFSQ PRHFCKTCRR YWTAGGSLRN VPVGGGSRKN KRSSSSSGLS  120
MNLTDLNTPC FPDQSAVSSD HNPNSTIHHE YHRDLKLAYP PNYTESKISS SSSASSSEFN  180
SFMGMPAAAS NSNANATCQS GNILLQEPKK TLDFSSSDGF ENNGARLWFP LQDIKPEISN  240
TTTDRFELNR GQAQAESTGY WTRLLGGGSW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441160.11e-173hypothetical protein CICLE_v10021862mg
TrEMBLA0A067F8Y70.0A0A067F8Y7_CITSI; Uncharacterized protein
STRINGVIT_16s0098g01420.t011e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3310622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.18e-28Dof family protein